LL-37

The only human cathelicidin antimicrobial peptide. Broad-spectrum antimicrobial with wound healing, anti-biofilm, and immunomodulatory properties. Links vitamin D to innate immunity.

Normal Protocol

Advanced Protocol

Overview

Also Known As

Human Cathelicidin, hCAP18 active fragment, CAMP, FALL-39 (earlier nomenclature)

Mechanism of Action

Cationic amphipathic peptide that disrupts microbial membranes. Recruits immune cells via FPRL1 receptor. Stimulates wound healing through keratinocyte migration. Induces angiogenesis. Modulates dendritic cell function. Anti-biofilm activity. Expression upregulated by vitamin D.

Product

Human Cathelicidin, hCAP18 active fragment, CAMP, FALL-39 (earlier nomenclature) vial
Dosing & Administration
Typical protocols and routes

Half-Life

Short; rapidly degraded by proteases in serum (minutes to hours depending on environment)

Administration Routes

subcutaneoustopicalintratumoral

Dosing Protocols

Average: 0.25 mg/day (vial lasts 20 days) — reconstitute 5 mg vial with 2 mL bacteriostatic water, draw 10 units on insulin syringe (marked up to 100 units). Advanced: 0.5 mg/day (vial lasts 10 days) — reconstitute 5 mg vial with 1 mL bacteriostatic water, draw 10 units on insulin syringe.
Research
Key findings and status

Key Research Findings

Grönberg et al. (2014): topical LL-37 improved chronic leg ulcer healing. Mader et al. (2011): intratumoral injection showed tumor regression in melanoma. Anti-biofilm efficacy demonstrated against MRSA and P. aeruginosa. Vitamin D-cathelicidin axis elucidated (Liu et al., 2006, Science).
Detailed Information

LL-37 is the only cathelicidin antimicrobial peptide found in humans. It is the active C-terminal fragment of the human cathelicidin antimicrobial protein (hCAP18), cleaved to its mature 37-amino acid form by proteinase 3. LL-37 serves as a critical component of the innate immune system and represents the front line of host defense against microbial pathogens.

Mechanism of Action

LL-37 functions through multiple antimicrobial and immunomodulatory mechanisms. As a cationic amphipathic alpha-helical peptide, it directly disrupts microbial cell membranes through electrostatic interaction with negatively charged phospholipids, creating pores that lead to microbial cell death. It is effective against a broad spectrum of Gram-positive and Gram-negative bacteria, enveloped viruses, and fungi.

Beyond direct antimicrobial activity, LL-37 functions as an immune alarm signal. It recruits neutrophils, monocytes, and T cells to infection sites via formyl peptide receptor-like 1 (FPRL1). It promotes wound healing by stimulating keratinocyte migration and proliferation, induces angiogenesis, and modulates the adaptive immune response by influencing dendritic cell differentiation and cytokine production.

Clinical Research

LL-37 has been investigated for wound healing, with clinical trials examining topical application for chronic venous leg ulcers (Grönberg et al., 2014) showing improved healing rates. It has been studied for its anti-biofilm properties, particularly relevant for chronic wound infections and implant-associated infections. Research into intratumoral LL-37 injection for melanoma has shown local immune activation and tumor regression in Phase I/II trials (Mader et al., 2011). Its role in vitamin D-mediated immunity (vitamin D upregulates cathelicidin expression) has important implications for understanding seasonal infection susceptibility.

Safety & Legal

Side Effects & Warnings

Topical: mild irritation at application site. Intratumoral: local inflammatory reaction (expected). Systemic: not well-characterized at therapeutic doses. At high concentrations, can be cytotoxic to host cells. Hemolytic at very high concentrations.

Legal Status

Research use only. Topical formulations under clinical investigation.
Molecular Data
Chemical properties

Molecular Weight

4493.33 g/mol

Amino Acid Sequence

[LL-37, 37 aa] (37 amino acids)

Quick Facts

Class

Thymic

Research Status

Clinical Trials

Half-Life

Short; rapidly degraded by proteases in serum (minutes to hours depending on environment)

Routes

subcutaneous
topical
intratumoral

Category

Immune & Thymic Peptides