TB-500 (Thymosin Beta-4)

Synthetic Thymosin Beta-4 promoting tissue repair through cell migration, angiogenesis, and anti-inflammatory mechanisms.

Overview

Also Known As

Thymosin Beta-4, Tβ4, TB4

Mechanism of Action

Upregulates actin expression, promotes cell migration to injury sites, stimulates angiogenesis, reduces inflammation via downregulation of inflammatory cytokines

Product

Dosing & Administration

Typical protocols and routes

Half-Life

Approximately 2-3 hours

Administration Routes

subcutaneousintramuscular

Dosing Protocols

Provider protocol: 1 mg subcutaneous daily. Reconstitute 10 mg vial with 1 mL bacteriostatic water, draw 10 units per dose (10 doses per vial). Some research protocols use 2-5 mg twice weekly with a loading phase, but daily 1 mg dosing is the recommended approach.

Research

Key findings and status

Key Research Findings

Demonstrated cardiac repair after myocardial infarction in animal models. Shown to promote corneal wound healing. Veterinary studies show efficacy for equine tendon and ligament injuries.

Detailed Information

TB-500 is a synthetic version of the naturally occurring peptide Thymosin Beta-4, a 43-amino acid protein that plays a critical role in tissue repair, cell migration, and blood vessel growth. It is one of the most widely studied healing peptides.

Overview

Thymosin Beta-4 is a naturally occurring peptide present in almost all tissues and cell types. TB-500 is the synthetic version used in research settings. It promotes healing by upregulating cell-building proteins like actin, facilitating cell migration to injury sites, and reducing inflammation.

Research Highlights

Studies have demonstrated TB-500’s ability to promote dermal and corneal wound healing, cardiac tissue repair following myocardial infarction, and neurological recovery after traumatic brain injury. It has shown particular promise in equine veterinary medicine for soft tissue injuries.

Safety & Legal

Side Effects & Warnings

Generally well-tolerated. Reported: temporary head rush, lethargy at injection site. Theoretical concern about promoting growth in existing tumors.

Legal Status

Research use only

Molecular Data

Chemical properties

Molecular Weight

4963.44 g/mol

Amino Acid Sequence

43-amino acid peptide: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES